Loading...
Statistics
Advertisement

We Buy Houses, Any Condition, Area & Price!
www.myfasthomebuyers.com/
cj8tyiFhulbqtGAVr-MMyBUMi5rjlglAGZPPa3J6FVc, We Buy Houses in broward, miami, dade, any condition or price range. We can pay all cash and close quickly.

Myfasthomebuyers.com

Advertisement
Myfasthomebuyers.com is hosted in United States / Melbourne . Myfasthomebuyers.com uses HTTPS protocol. Number of used technologies: 4. First technologies: CSS, Html, Javascript, Number of used javascripts: 5. First javascripts: Jquery-1.4.2.min.js, Jquery-ui-1.8.17.custom.min.js, Jquery.fancybox-1.3.4.pack.js, Number of used analytics tools: 0. Its server type is: .

Technologies in use by Myfasthomebuyers.com

Technology

Number of occurences: 4
  • CSS
  • Html
  • Javascript
  • jQuery UI

Advertisement

Javascripts

Number of occurences: 5
  • jquery-1.4.2.min.js
  • jquery-ui-1.8.17.custom.min.js
  • jquery.fancybox-1.3.4.pack.js
  • highslide_full_packed_4-1.js
  • highslide_custom.js

Powered by

  • ASP.NET:

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Myfasthomebuyers.com

SSL certificate

    • name: /OU=Domain Control Validated/CN=*.inetusa.com
    • subject:
      • OU: Domain Control Validated
      • CN: *.inetusa.com
    • hash: d690683d
    • issuer:
      • C: US
      • ST: Arizona
      • L: Scottsdale
      • O: GoDaddy.com, Inc.
      • OU: http://certs.godaddy.com/repository/
      • CN: Go Daddy Secure Certificate Authority - G2
    • version: 2
    • serialNumber: 13507980444604642932
    • validFrom: 151112165338Z
    • validTo: 161111203638Z
    • validFrom_time_t: 1447347218
    • validTo_time_t: 1478896598
    • extensions:
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • keyUsage: Digital Signature, Key Encipherment
      • crlDistributionPoints: Full Name: URI:http://crl.godaddy.com/gdig2s1-153.crl
      • certificatePolicies: Policy: 2.16.840.1.114413.1.7.23.1 CPS: http://certificates.godaddy.com/repository/
      • authorityInfoAccess: OCSP - URI:http://ocsp.godaddy.com/ CA Issuers - URI:http://certificates.godaddy.com/repository/gdig2.crt
      • authorityKeyIdentifier: keyid:40:C2:BD:27:8E:CC:34:83:30:A2:33:D7:FB:6C:B3:F0:B4:2C:80:CE
      • subjectAltName: DNS:*.inetusa.com, DNS:inetusa.com
      • subjectKeyIdentifier: 58:29:1F:2D:DC:3C:52:61:72:03:FA:D2:D9:80:3C:55:6D:A9:49:9F

Meta - Myfasthomebuyers.com

Number of occurences: 3
  • Name: keywords
    Content: cj8tyiFhulbqtGAVrMMyBUMi5rjlglAGZPPa3J6FVc, We buy houses, buy my house, broward, palm beach, miami, dade, homes, property, properties, land, sell, purchase, lease, payoff, takeover payments, lend, option, money, for sale by owner, FSBO, fizbo, rent, tired landlord, creative financing, investor, creative, help, foreclosure, stop, avoid, escape, debt relief, real estate wanted, mortgage, over leveraged, no equity, fast, cash, quick close, divorce, estate sale, fire damage, probate, behind on payments, needs work, TLC, handyman special, condition, price range, sell your house in days, fast, friendly, flexible, integrity, realty, real estate investor, broker, realtor, investing, REIA, Sell Your Home, solutions, problems, solved, auction, sheriff sale
  • Name: description
    Content: cj8tyiFhulbqtGAVr-MMyBUMi5rjlglAGZPPa3J6FVc, We Buy Houses in broward, miami, dade, any condition or price range. We can pay all cash and close quickly.
  • Name: google-site-verification
    Content: cj8tyiFhulbqtGAVr-MMyBUMi5rjlglAGZPPa3J6FVc

Server / Hosting

  • IP: 66.220.170.187
  • Latitude: 28.07
  • Longitude: -80.62
  • Country: United States
  • City: Melbourne

Rname

  • grouper.tng.net
  • redfish.tng.net
  • ASPMX5.GOOGLEMAIL.com
  • ASPMX.L.GOOGLE.com
  • ALT1.ASPMX.L.GOOGLE.com
  • ALT2.ASPMX.L.GOOGLE.com
  • ASPMX2.GOOGLEMAIL.com
  • ASPMX3.GOOGLEMAIL.com
  • ASPMX4.GOOGLEMAIL.com

Target

  • support.tng.net

HTTP Header Response

HTTP/1.1 200 OK Content-Type: text/html; charset=UTF-8 X-Powered-By: ASP.NET: Set-Cookie: CFID=217102574;expires=Thu, 16-Aug-2046 18:18:57 GMT;path=/ Set-Cookie: CFTOKEN=310373e0a9ea60a6-B8A06F7B-F324-259C-4ECBE36C8D4024BE;expires=Thu, 16-Aug-2046 18:18:57 GMT;path=/ Set-Cookie: JSESSIONID=9830e6e4457fe1d739102e62c79391122121;path=/ P3P: CP="NOI DSP COR DEVa TAIa OUR BUS UNI Date: Tue, 23 Aug 2016 18:18:56 GMT X-Cache: MISS from s_wx1011 X-Cache-Lookup: MISS from s_wx1011:80 Transfer-Encoding: chunked Via: 1.1 s_wx1011 (squid/3.5.20) Connection: keep-alive

DNS

host: myfasthomebuyers.com
  1. class: IN
  2. ttl: 10800
  3. type: A
  4. ip: 66.220.170.187
host: myfasthomebuyers.com
  1. class: IN
  2. ttl: 10800
  3. type: NS
  4. target: grouper.tng.net
host: myfasthomebuyers.com
  1. class: IN
  2. ttl: 10800
  3. type: NS
  4. target: redfish.tng.net
host: myfasthomebuyers.com
  1. class: IN
  2. ttl: 10800
  3. type: SOA
  4. mname: ns1.cniweb.net
  5. rname: support.tng.net
  6. serial: 2012031301
  7. refresh: 10800
  8. retry: 3600
  9. expire: 604800
  10. minimum-ttl: 3600
host: myfasthomebuyers.com
  1. class: IN
  2. ttl: 10800
  3. type: MX
  4. pri: 30
  5. target: ASPMX5.GOOGLEMAIL.com
host: myfasthomebuyers.com
  1. class: IN
  2. ttl: 10800
  3. type: MX
  4. pri: 10
  5. target: ASPMX.L.GOOGLE.com
host: myfasthomebuyers.com
  1. class: IN
  2. ttl: 10800
  3. type: MX
  4. pri: 20
  5. target: ALT1.ASPMX.L.GOOGLE.com
host: myfasthomebuyers.com
  1. class: IN
  2. ttl: 10800
  3. type: MX
  4. pri: 20
  5. target: ALT2.ASPMX.L.GOOGLE.com
host: myfasthomebuyers.com
  1. class: IN
  2. ttl: 10800
  3. type: MX
  4. pri: 30
  5. target: ASPMX2.GOOGLEMAIL.com
host: myfasthomebuyers.com
  1. class: IN
  2. ttl: 10800
  3. type: MX
  4. pri: 30
  5. target: ASPMX3.GOOGLEMAIL.com
host: myfasthomebuyers.com
  1. class: IN
  2. ttl: 10800
  3. type: MX
  4. pri: 30
  5. target: ASPMX4.GOOGLEMAIL.com

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.yfasthomebuyers.com, www.mpyfasthomebuyers.com, www.pyfasthomebuyers.com, www.moyfasthomebuyers.com, www.oyfasthomebuyers.com, www.miyfasthomebuyers.com, www.iyfasthomebuyers.com, www.mkyfasthomebuyers.com, www.kyfasthomebuyers.com, www.m.yfasthomebuyers.com, www..yfasthomebuyers.com, www.muyfasthomebuyers.com, www.uyfasthomebuyers.com, www.mjyfasthomebuyers.com, www.jyfasthomebuyers.com, www.mnyfasthomebuyers.com, www.nyfasthomebuyers.com, www.m-yfasthomebuyers.com, www.-yfasthomebuyers.com, www.mfasthomebuyers.com, www.myzfasthomebuyers.com, www.mzfasthomebuyers.com, www.myafasthomebuyers.com, www.mafasthomebuyers.com, www.mysfasthomebuyers.com, www.msfasthomebuyers.com, www.mydfasthomebuyers.com, www.mdfasthomebuyers.com, www.myfasthomebuyers.com, www.mfasthomebuyers.com, www.mycfasthomebuyers.com, www.mcfasthomebuyers.com, www.my fasthomebuyers.com, www.m fasthomebuyers.com, www.myasthomebuyers.com, www.myfqasthomebuyers.com, www.myqasthomebuyers.com, www.myfasthomebuyers.com, www.myasthomebuyers.com, www.myfaasthomebuyers.com, www.myaasthomebuyers.com, www.myfyasthomebuyers.com, www.myyasthomebuyers.com, www.myftasthomebuyers.com, www.mytasthomebuyers.com, www.myfgasthomebuyers.com, www.mygasthomebuyers.com, www.myfbasthomebuyers.com, www.mybasthomebuyers.com, www.myfwasthomebuyers.com, www.mywasthomebuyers.com, www.myfsasthomebuyers.com, www.mysasthomebuyers.com, www.myfdasthomebuyers.com, www.mydasthomebuyers.com, www.myfrasthomebuyers.com, www.myrasthomebuyers.com, www.myf3asthomebuyers.com, www.my3asthomebuyers.com, www.myf4asthomebuyers.com, www.my4asthomebuyers.com, www.myfsthomebuyers.com, www.myfaosthomebuyers.com, www.myfosthomebuyers.com, www.myfapsthomebuyers.com, www.myfpsthomebuyers.com, www.myfa9sthomebuyers.com, www.myf9sthomebuyers.com, www.myfasthomebuyers.com, www.myfsthomebuyers.com, www.myfaisthomebuyers.com, www.myfisthomebuyers.com, www.myfausthomebuyers.com, www.myfusthomebuyers.com, www.myfathomebuyers.com, www.myfasethomebuyers.com, www.myfaethomebuyers.com, www.myfaswthomebuyers.com, www.myfawthomebuyers.com, www.myfasdthomebuyers.com, www.myfadthomebuyers.com, www.myfasxthomebuyers.com, www.myfaxthomebuyers.com, www.myfasfthomebuyers.com, www.myfafthomebuyers.com, www.myfasgthomebuyers.com, www.myfagthomebuyers.com, www.myfastthomebuyers.com, www.myfatthomebuyers.com, www.myfashomebuyers.com, www.myfastqhomebuyers.com, www.myfasqhomebuyers.com, www.myfastahomebuyers.com, www.myfasahomebuyers.com, www.myfast homebuyers.com, www.myfas homebuyers.com, www.myfastwhomebuyers.com, www.myfaswhomebuyers.com, www.myfastehomebuyers.com, www.myfasehomebuyers.com, www.myfastzhomebuyers.com, www.myfaszhomebuyers.com, www.myfastxhomebuyers.com, www.myfasxhomebuyers.com, www.myfastchomebuyers.com, www.myfaschomebuyers.com, www.myfastomebuyers.com, www.myfastheomebuyers.com, www.myfasteomebuyers.com, www.myfasthdomebuyers.com, www.myfastdomebuyers.com, www.myfasthcomebuyers.com, www.myfastcomebuyers.com, www.myfasthuomebuyers.com, www.myfastuomebuyers.com, www.myfasthjomebuyers.com, www.myfastjomebuyers.com, www.myfasthomebuyers.com, www.myfastomebuyers.com, www.myfasthbomebuyers.com, www.myfastbomebuyers.com, www.myfasthgomebuyers.com, www.myfastgomebuyers.com, www.myfasthmebuyers.com, www.myfasthobmebuyers.com, www.myfasthbmebuyers.com, www.myfasthohmebuyers.com, www.myfasthhmebuyers.com, www.myfasthogmebuyers.com, www.myfasthgmebuyers.com, www.myfasthojmebuyers.com, www.myfasthjmebuyers.com, www.myfasthommebuyers.com, www.myfasthmmebuyers.com, www.myfastho mebuyers.com, www.myfasth mebuyers.com, www.myfasthovmebuyers.com, www.myfasthvmebuyers.com, www.myfasthoebuyers.com, www.myfasthompebuyers.com, www.myfasthopebuyers.com, www.myfasthomoebuyers.com, www.myfasthooebuyers.com, www.myfasthomiebuyers.com, www.myfasthoiebuyers.com, www.myfasthomkebuyers.com, www.myfasthokebuyers.com, www.myfasthom.ebuyers.com, www.myfastho.ebuyers.com, www.myfasthomuebuyers.com, www.myfasthouebuyers.com, www.myfasthomjebuyers.com, www.myfasthojebuyers.com, www.myfasthomnebuyers.com, www.myfasthonebuyers.com, www.myfasthom-ebuyers.com, www.myfastho-ebuyers.com, www.myfasthombuyers.com, www.myfasthomexbuyers.com, www.myfasthomxbuyers.com, www.myfasthomesbuyers.com, www.myfasthomsbuyers.com, www.myfasthomewbuyers.com, www.myfasthomwbuyers.com, www.myfasthomerbuyers.com, www.myfasthomrbuyers.com, www.myfasthomefbuyers.com, www.myfasthomfbuyers.com, www.myfasthomevbuyers.com, www.myfasthomvbuyers.com, www.myfasthomecbuyers.com, www.myfasthomcbuyers.com, www.myfasthomeqbuyers.com, www.myfasthomqbuyers.com, www.myfasthomeabuyers.com, www.myfasthomabuyers.com, www.myfasthomeybuyers.com, www.myfasthomybuyers.com,

Other websites we recently analyzed

  1. Livingston Lures | Designed to call the fish to you!
    The first and only fishing lure to feature an internal sound chamber that emits the sound of an injured baitfish upon contact with water.
    San Antonio (United States) - 23.253.64.63
    Server software: Apache
    Technology: CSS, Html, Html5, Javascript, jQuery, jQuery Colorbox, jQuery Cycle, jQuery Fancybox, jQuery Hover Intent, Php, Swf Object, Facebook Retargeting, Google Analytics, Drupal, Facebook Box, Twitter Button
    Number of Javascript: 50
    Number of meta tags: 8
  2. 初年次教育学会(JAFYE)
    Tokyo (Japan) - 58.138.174.50
    Server software:
    Technology: CSS, Google Font API, Html, Html5, Javascript, jQuery, Php, Pingback, Wordpress
    Number of Javascript: 5
    Number of meta tags: 3
  3. eliorsh.com
    Scottsdale (United States) - 184.168.221.33
    Server software: squid/3.5.12
    Technology: Html, Html5, Iframe
  4. Propaganda Kompany
    Shop powered by PrestaShop
    France - 213.186.33.4
    Server software: Apache
    Technology: CSS, Html, Javascript, Php, Google Analytics, Prestashop
    Number of Javascript: 11
    Number of meta tags: 5
  5. Welcome to INSPIREDTRANSITION.COM
    Scottsdale (United States) - 184.168.221.96
    Server software: Microsoft-IIS/7.5
    Technology: Google Adsense, CSS, Html, Javascript
    Number of Javascript: 3
    Number of meta tags: 1
  6. maidservicegivesladyperfectlife.com
    United States - 66.151.177.21
    Server software: nginx
    Technology: DoubleClick.Net, CSS, Html, Javascript, Google Analytics
    Number of Javascript: 7
    Number of meta tags: 5
  7. schoene-natuerliche-zaehne.de
    Hier entsteht
    Germany - 89.31.143.16
    Server software: Apache
    Technology: CSS, Html, SVG
    Number of meta tags: 3
  8. Derek Nicolson Computer Services
    United Kingdom - 87.239.18.198
    Server software: nginx
    Technology: CSS, Html, Html5, Javascript, Php, Pingback, Wordpress
    Number of meta tags: 4
  9. cleariwirere.no.com
    San Jose (United States) - 205.164.14.88
    Server software: Tengine/1.4.2
    Technology: Google Adsense, Html, Javascript, Php
    Number of Javascript: 2
    Number of meta tags: 1
  10. swifthitch.co.uk
    Gloucester (United Kingdom) - 213.171.195.105
    Server software: nginx/1.6.3
    Technology: CSS, Html, Html5, Javascript
    Number of meta tags: 5

Check Other Websites